viernes, 17 de enero de 2014

reprimir plasticidad sináptica

uña del pulgarLos factores que inhiben el crecimiento de fibras nerviosas contribuyen sustancialmente a la capacidad de regeneración limitada del sistema nervioso central adulto (SNC) después de la lesión. Juegan un papel importante en la estabilización del complejo de cableado del SNC adulto de vertebrados superiores y en el establecimiento de vías neuronales en el sistema nervioso en desarrollo [1] , [2] . Uno de los factores mejor estudiadas es la proteína de membrana de Nogo-A, que se produce en la mielina y ciertas neuronas, la inhibición de la regeneración axonal y la plasticidad después de lesión del SNC [3] - [5] . La neutralización de Nogo-A se ha mostrado para mejorar el crecimiento axonal y la brotación compensatoria en el adulto la médula espinal y el cerebro, así como para mejorar la recuperación funcional después de una lesión del SNC [4] , [6] . Estudios recientes han demostrado nuevos papeles importantes de Nogo-A de señalización en la represión de la plasticidad sináptica en las redes neuronales maduros, lo que indica un potencial inhibidor de Nogo-A mucho más allá de su restricción bien estudiado de crecimiento axonal [1] , [7] - [ 11] .
Nogo-A ejerce sus efectos inhibidores a través de dos dominios distintos: extracelulares de Nogo-66 (aminoácidos de rata (aa) 1026-1091) y de Nogo-A-Δ20 (rata aa544-725; parte de "Amino-Nogo") [2] , [12] . Nogo-66 induce la inhibición del crecimiento a través de dos proteínas de membrana, Nogo-66 del receptor 1 (NgR1) [13] , junto con las proteínas accesorias, y emparejado similar a inmunoglobulina del receptor B (PirB) [14] . Por el contrario, la identificación molecular y la caracterización del receptor (s) de transducción de señales desde el dominio inhibidora de Nogo-A-Δ20 ha fracasado hasta el momento [2] . Nogo-A-Δ20 se ha demostrado que mediar parcialmente su actividad inhibidora al interferir con las integrinas, pero la prueba de una interacción directa ha sido difícil de alcanzar [15] . Aquí hemos identificado el receptor acoplado a proteína G (GPCR) de la esfingosina 1-fosfato del receptor 2 (S1PR2) como un receptor funcional para el dominio Δ20 de Nogo-A.
S1PR2 pertenece a la subfamilia de cinco S1PRs [16] . S1PRs son conocidos por ser activado por el bajo peso molecular (MW) de la esfingosina ligando de lípidos 1-fosfato (S1P), que ejerce diversos efectos específicos del receptor en diversos tipos de células, incluyendo la regulación de la apoptosis, la motilidad celular y la dinámica del citoesqueleto [16] . En el cerebro y la médula espinal, S1P se ha demostrado que regulan la angiogénesis y el crecimiento de neuritas: activación de S1PR1 promueve el crecimiento de neuritas in vitro a través de G i / o y Rac1, mientras que la activación de S1PR2 conduce a la retracción de las neuritas, que implica G i / o, G Q, o G 12/13 y la vía de RhoA [16] - [18] .
En este estudio hemos demostrado que Nogo-A-Δ20 se une S1PR2 a través del receptor extracelular bucles 2 y 3, que son distintos del sitio de unión descrito previamente de S1P [19]. Señales de Nogo-A-Δ20 a través de la proteína G G 13, Rho factor de intercambio de guanina leucemia asociada (RhoGEF) LARG y RhoA. Eliminación o bloqueo S1PR2 contrarresta Nogo-A-Δ20-y la inhibición de la mielina mediada por el crecimiento de neuritas y la propagación de células. Bloqueo agudo S1PR2 aumenta hipocampo y cortical plasticidad sináptica a largo plazo similar a Nogo-A de neutralización. Estos resultados refuerzan el papel fisiológico recientemente propuesta del Nogo-A en la restricción de la plasticidad sináptica para estabilizar los circuitos neuronales [1] , [9] . Además, estos datos apoyan el cambio de paradigma para la señalización de GPCR de la clásica "un ligando - un receptor" situación hacia modelos más dinámicos [20] , [21] .

Resultados

Nogo-A se une a S1PR2

El GPCR S1PR2 fue identificado como un candidato nuevo receptor del dominio Nogo-A-Δ20 usando una levadura de dos híbridos de pantalla (Y2H) del adulto a medida y bibliotecas cerebrales fetales humanos. En el SNC adulto, S1PR2 se expresa principalmente en la materia gris ( Figura 1 ). Células del hipocampo piramidales, las células de Purkinje del cerebelo, neuronas corticales y motoneuronas espinales, así como las células ganglionares de la retina son S1PR2-positivo ( Figura 1A-1K ). Es importante destacar que, S1PR2 también se expresa en células de Nogo-A-Δ20-respuesta in vitro incluyendo fibroblastos 3T3 y neuronas granulares de cerebelo inmaduras ( Figura S1 ). Para validar la interacción de Nogo-A-Δ20 (Figura 2A ) y S1PR2, Su-etiquetados Nogo-A-Δ20 se co-incubaron con las membranas de las células que sobreexpresan S1PR2 y immunoprecipitated (posteriormente Figura 2C ). S1PR2 se detectó específicamente en fracciones de inmunoprecipitación ( Figura 2 C ). Viceversa, marcado con His de Nogo-A-Δ20 podría palpar específicamente en S1PR2 fracciones inmunoprecipitadas, lo que sugiere que las dos proteínas interactúan in vitro ( Figura 2D ).Experimentos de co-inmunoprecipitación de Nogo-A o S1PR2 de extractos de proteínas de cerebro de ratón enteros demostraron además que endógena S1PR2 interactúa con Nogo-A en condiciones fisiológicas in vivo ( Figura 2B ). Para determinar la afinidad de unión, la unión de todo el dominio que contiene Δ20-extracelular N-terminal de Nogo-A (Nogo-A-ext; Figura 2A ) preparaciones de membrana inmovilizados en biosensores a que expresan la proteína funcional S1PR2 longitud completa o no el control S1PR2-expresando membranas se monitorizó en tiempo real utilizando Bio-Capa de la interferometría (OctetRED). Montaje no lineal reveló que Nogo-A-ext une a S1PR2 con un equilibrio aparente vinculante constante (K D) de ~ 142 nM (Figura 2E ). La afinidad de unión no fue influenciado por la adición de S1P en comparación con el control del vehículo (MeOH) (K D MeOH ~ 192 nM; K D ~ S1P 202 nM; Figura 2F ). Para un mapeo de sitios de unión, los dominios extracelulares individuales (N-terminal y bucles extracelulares [LCE]) de S1PR2 fueron sintetizados como péptidos y se analizaron para la unión a Nogo-A-Δ20 por termoforesis microescala ( Figura 2G ). Nogo-A-Δ20 se encontró que se unen principalmente a ECL2 (K D ~ 280 nM) y 3 (K D ~ 350 nM), menos fuertemente a ECL1 (K D ~ 2 M) y insignificantemente a la N-terminal de S1PR2 ( K D ~ 11 M) ( Figura 2G ).Es importante destacar que el análisis de unión del otro dominio bioactivo de Nogo-A, Nogo-66, a S1PR2 dominios extracelulares reveladas sólo inespecífico de unión en el intervalo micromolar alta (K D ECL1 ~ 46 M; K D ECL2 ~ 7 M; K D ECL3 ~ 67 mM) o ausencia completa de unión (N-terminal) ( Figura 2H ). Colectivamente, estos datos muestran que Nogo-A-Δ20 pero no de Nogo-66 se une a los dominios extracelulares específicos de GPCR S1PR2.
Figura 1. Localización de S1PR2 por inmunohistoquímica en el ratón adulto CNS.
(A) S1PR2 expresión en el hipocampo. CA, ammonis cornu, DG, giro dentado. (B) Ampliación de la región CA1 de caja representado en (A). (C) S1PR2 expresión en el cerebelo. GCL, capa de células granulares; ML, capa molecular; PCL, capa de células de Purkinje. (D) Aumento de la región de caja se representa en (C). (E) S1PR2 expresión en la corteza motora. (F) Aumento de la región de caja representado en (E).(G, H) expresión S1PR2 en los cuerpos celulares de las motoneuronas (flechas) y las fibras βIII-tubulina-positivos (puntas de flecha) en la médula espinal. (I, J, K) expresión S1PR2 en los axones paquetes βIII-tubulina-positivos (puntas de flecha) y cuerpos celulares (flechas) de las células ganglionares de la retina. Las barras de escala: (A) 300 m; (B) 30 micras; (C) 200 m; (D) 15 micras; (E) 90 m; (F) 30 m; (G, H) 20 m; (I- K) 15 micras.
doi: 10.1371/journal.pbio.1001763.g001
Figura 2. Nogo-A se une a S1PR2.
(A) Estructura esquemática de Nogo-A muestra los dominios inhibitorios Nogo-A-Δ20 (Δ20, naranja), Nogo-66 (azul) y Nogo-A-ext. Los dominios transmembrana se indican en gris oscuro. RHD, dominio de homología reticulon. (B) Nogo-A (~ 200 kDa) co-immunoprecipitated con S1PR2 (~ 40 kDa) y viceversa en WT, pero no Nogo-A - / - o S1PR2 - / - extractos de cerebro (BE). Si se especifica, se utilizaron los siguientes controles en WT SER en lugar del anticuerpo IP para confirmar la especificidad de la interacción: IgG, anticuerpo de control; Ctrl R, resina único control; Qabr, el anticuerpo se inactivó (Ab) de control de resina. Control de carga de entrada: β-actina (~ 42 kDa).(C) S1PR2 inmunoprecipitada con Su-etiquetados Δ20 pero no inactivado por calor (hi) Δ20 en las membranas S1PR2 sobreexpresan. Control de carga de entrada: S1PR2. (D) Su-etiquetados Δ20 pero no hi Δ20 immunoprecipitated con S1PR2 en las membranas S1PR2 sobreexpresan. Control de carga de entrada: S1PR2. (E) Nogo-A-ext une específicamente al biosensor inmoviliza-S1PR2 sobreexpresan frente membranas de control (K D ~ 142 nm). Un análisis de la representación de Scatchard se muestra a la derecha. (F) 1 M de S1P no modula la interacción entre Nogo-A-ext y S1PR2 en comparación con el metanol (MeOH) de control de vehículo (MeOH, K D ~ 192 nM; S1P,K D ~ 202 nM). Un análisis de la representación de Scatchard se muestra a la derecha.(G) a microescala termoforesis análisis de unión de Δ20 a S1PR2 dominios extracelulares: ECL2 (K D ~ 280 nM), ECL3 (K D ~ 350 nM), ECL1 (K D ~ 1,7 M), y N-terminal (K D ~ 11 M). ECL1 revueltos (ECL1-SCR) se utilizó como control (K D ~ 17 M).Las flechas indican los bucles de unión Δ20-identificados en S1PR2. (H) Nogo-66 la unión a dominios extracelulares S1PR2 es inespecífica: ECL2 (K D ~ 7 M), ECL1 (K D ~ 46 M), ECL3 (K D ~ 67 M). No se unión a la N-terminal o a ECL1-SCR se observa.
doi: 10.1371/journal.pbio.1001763.g002

S1PR2 se internaliza en Nogo-A-Δ20 Encuadernación

Hemos demostrado previamente que Nogo-A-Δ20 es internalizado en endosomas de señalización tras la unión, lo que resulta en la activación de RhoA y el crecimiento de cono colapso [22] . Para investigar si S1PR2 es co-internaliza tras el tratamiento Nogo-A-Δ20, superficie celular S1PR2 expresión fue analizada por inmunofluorescencia utilizando un anticuerpo a medida ( Figuras 3A , S2B y S2C). De la superficie celular S1PR2 niveles se redujeron en ~ 64% (p <0,001) 30 min después de la adición de Nogo-A-Δ20 ( Figura 3B ).Para confirmar esto, las membranas de plasma de células 3T3 se prepararon 15 y 30 minutos después de la incubación con Nogo-A-Δ20 y se analizaron para los niveles de S1PR2 por inmunotransferencia ( Figuras 3C y S2A ). Se encontró que los niveles de la superficie celular S1PR2 se redujeron en ~ 77% (p <0,01) y ~ 70% (p <0,001) después de 15 y 30 min de incubación con Nogo-A-Δ20, respectivamente, lo que indica que S1PR2 se internaliza tras la unión a Nogo-A-Δ20 ( Figura 3C ). Experimentos de pulso-caza revelaron que la mayoría de los puntos lagrimales internalizados de Nogo-A-Δ20 colocalize con S1PR2 así como con la EEA1 marcador endosomal a los 15 y 30 minutos después de la incubación con Nogo-A-Δ20 ( Figura 3D ). La ubiquitinación de los GPCR es una modificación post-traduccional crítico, que a menudo es prescindible para la endocitosis del receptor inicial, pero importante para endosomal tráfico a proteasoma / lisosomales vías de degradación [23] , [24] . S1P se ha demostrado que causa S1PR1 monoubiquitination y, en concentraciones más altas, polyubiquitination, lo que resulta en el reciclaje de GPCR posterior a la membrana o la degradación completa, respectivamente [25] . Conjugados S1PR2-ubiquitina no se detectaron después de la internalización de Nogo-A-Δ20 en lugar de S1P ( Figura 3E ), lo que indica que la señalización de Nogo-A-Δ20 no se termina de forma permanente en la ruta de degradación lisosomal [23] - [25] . Estos resultados sugieren que S1PR2 es rápidamente internalizado con co-Nogo-A-Δ20 en los endosomas tempranos tras la unión, que se sabe que es un paso clave para la inhibición del crecimiento mediada por Nogo-A-Δ20 [22] .
Figura 3. S1PR2 se internaliza en Nogo-A-Δ20 de unión.
(A) micrografías confocal representativos de 3T3 células teñidas con vida (no permanente) o fijos (Perm) para S1PR2 antes (control) y 30 minutos después de la Δ20 tratamiento a 37 ° C. (B) la cuantificación de fluorescencia media intensidad de la tinción de la superficie celular se muestra en (A). (C) Adición de Δ20 downregulates S1PR2 superficie celular en 3T3 membranas plasmáticas (PM): inmunoblot y la cuantificación relativa de los mismos. Control de carga: β-actina. (D) micrografías confocales representativos de 3T3 células incubadas con HA-etiquetados 1 M Δ20 durante 1 hora a 4 ° C (de impulsos), que fueron posteriormente persiguió durante 15 y 30 min a 37 ° C. Las células se tiñeron con un anticuerpo anti-HA (Δ20), S1PR2, o anticuerpo EEA1 (endosomas tempranos). Las flechas indican Δ20 células unido a la superficie (panel superior) o colocalización de Δ20 y S1PR2 en endosomas tempranos (panel central e inferior). El panel recuadro muestra una vista ampliada de la región en caja. (E) Western blot de las fracciones de proteínas ubiquitinated y no ubiquitinadas de células 3T3 30 min después Δ20 o tratamiento S1P. Los datos mostrados son medias ± SEM (n = 3-6 experimentos; ** p <0,01, *** p <0,001). Las barras de escala: (A, D) 50 micras.
doi: 10.1371/journal.pbio.1001763.g003

Inhibición-A-Δ20 inducida por Nogo S1PR2 Mediates de propagación de células y Extensión de Neuritas

Nogo-A-Δ20 ejerce fuertes efectos inhibitorios sobre el crecimiento y la adhesión de diferentes tipos de células neuronales y, a diferencia de Nogo-66, también en células no neuronales, tales como fibroblastos 3T3, que carezcan de NgR1 expresión [12] . Para determinar el papel funcional de S1PR2 para los efectos mediados-Nogo-A-Δ20 in vitro, el bloqueador de S1PR2 bien caracterizado JTE-013 [26] se probó por su capacidad para revertir la inhibición mediada por Nogo-A-Δ20 de la propagación de células. El tratamiento de células 3T3 con JTE-013 contrarrestó significativamente la inhibición de la propagación de células mediada por Nogo-A-Δ20, resultando en un ~ 24% de aumento de células propagadas en comparación con vehículo (DMSO) (p <0,05) ( Figura 4A y 4B ). Del mismo modo, en la mielina, la propagación de células se incrementó en ~ 56% (p <0,001) ( Figura 4A y 4B ). Estos efectos fueron dependientes de la dosis ( Figura S3A ) y-específico subtipo S1PR ( Figura S3B ): bloqueo de S1PR1 con W146, S1PR1 y 3 con VPC-23019, S1PR1, 3, 4, y 5 con FTY-720 o con un S1PR5 función de bloqueo de anticuerpos [27] no tuvo ningún efecto sobre la inhibición de la propagación de células mediada por Nogo-A-Δ20 ( Figura S3B ). Además, ningún efecto sinérgico se observó mediante la combinación de JTE-013 con cualquiera de estos agentes de bloqueo ( Figura s3c ), lo que sugiere que únicamente S1PR2 es responsable de los efectos mediados-Nogo-A-Δ20 en células 3T3. Para subrayar la importancia funcional de S1PR2, su expresión fue silenciado retrovirus en células 3T3 (sh-S1pr2; Figura S4A y S4B ).Desmontables de S1PR2 resultó en un muy fuerte aumento de la propagación de células en una de Nogo-A-Δ20 (~ 51%, p <0,001) o mielina (~ 44%, p <0,001) de sustrato en comparación con el vector de control (SH-Vec ) ( Figura 4C y 4D ). Del mismo modo, el ratón fibroblastos embrionarios primarios (MEFs) aislado de S1PR2 - / - ratones [28] fueron significativamente menos inhibidos por Nogo-A-Δ20 (~ 41%, p <0,01) o la mielina (~ 36%, p <0,01) cuando en comparación con (WT) MEFs (de tipo salvaje Figura 4E y 4F ).
Figura 4. S1PR2 media de Nogo-A-Δ20-y la inhibición inducida por la mielina de la propagación celular y el crecimiento de neuritas.
(A, C) imágenes representativas de los fibroblastos 3T3 tratadas con JTE-013 o vehículo (DMSO) (A), o de forma estable que lleva un S1pr2 shRNA (sh-S1pr2) o el vector vacío (sh-Vec) construcción (C) y chapada en de control, de Nogo-A-Δ20 o sustratos de mielina. (B, D) la difusión de la cuantificación de (A) y (C) de la célula. (E) las imágenes representativas de MEFs aisladas de WT o S1PR2 - / - ratones y chapada en el control, Nogo-A-Δ20, o sustratos de mielina. (F) la difusión de la célula cuantificación de (E).Las células se tiñeron con Alexa488-conjugado faloidina en (A, C, y E). (G, I) imágenes representativas de P5-8 neuronas granulares del cerebelo tratados con JTE-013 o DMSO (G), o aisladas de S1PR2 - / - o ratones WT (I) y chapada en PLL (ctrl), Nogo-A- Δ20 o sustratos de mielina. (H, J) normalizada significa la longitud de neuritas por célula de cuantificación (G) y (I). Las neuronas se tiñeron con βIII-tubulina en (G) y (I). Los datos mostrados son medias ± SEM (n = 3-6 experimentos, * p <0,05, ** p <0,01, *** p <0,001). Las barras de escala: 50 m.
doi: 10.1371/journal.pbio.1001763.g004
Para investigar la importancia funcional de S1PR2 en la inhibición mediada por el crecimiento de neuritas-Nogo-A-Δ20, nos centramos en el día postnatal (P) 5-8 neuronas granulares del cerebelo que expresan S1PR2 ( Figura S1B ). El bloqueo farmacológico de S1PR2 usando JTE-013 dio lugar a un ~ 39% (p <0,01) y ~ 44% (p <0,05) aumento en consecuencia en una de Nogo-A-Δ20 y sustrato de mielina, respectivamente ( Figura 4G y 4H ). Del mismo modo, nocaut de S1PR2 también aumentó el crecimiento de neuritas por ~ 51% (p <0,001) y ~ 69%(p <0,001) en una de Nogo-A-Δ20 y sustrato de mielina, respectivamente ( Figura 4I y 4J ).Juntos, estos resultados proporcionan una fuerte evidencia de que S1PR2 actúa como un receptor funcional para Nogo-A-Δ20. Es importante destacar que, la aplicación de JTE-013 no tuvo efecto sobre un Nogo-66 o Aggrecan sustrato inhibidor del crecimiento ( Figura S5 ).

Señales Nogo-A-Δ20 a G 13, LARG y RhoA

El G proteínas G Q, G 12 y G 13, se mostró a interactuar con S1PR2 y para activar la pequeña GTPasa RhoA [16] , [29] . Para determinar si el G q, G 12, o G 13 están implicados en la inhibición de la propagación de células mediada por Nogo-A-Δ20, transfectadas pequeños RNAs de interferencia (siRNAs) dirigidas a los ARNm de las proteínas G ( Figura S4C y S4D ).Regulación a la baja de T 13, pero no de T Q o G 12 celular totalmente rescatado se extiende desde ~ 63% a ~ 134% en Nogo-A-Δ20 en comparación con el control de siRNA (p <0,01) (Figura 5A ). No se observó efecto acumulativo por la co-aplicación de JTE-013, lo que sugiere que el G 13 es un regulador clave de los efectos mediados-Nogo-A-Δ20 aguas abajo de S1PR2 ( Figura 5A ). Por consiguiente, la inhibición de la G unida-Rac1 i / o proteína [16] con toxina pertussis (PTX) no tuvo ningún efecto sobre la inhibición de la propagación de células mediada por Nogo-A-Δ20 ( Figura 5A ). Para evaluar si el G 13 también está involucrado en la inhibición mediada por Nogo-A-Δ20 del crecimiento de neuritas, G 13 fue silenciado en E19 de rata neuronas corticales utilizando siRNAs específicos ( Figura S4E y S4F ). Desmontables de T13, pero no de G 12 excrecencia rescatado específicamente de ~ 68% a ~ 87% en Nogo-A-Δ20 en comparación con el control de siRNA (p <0,05) ( Figura 5B ). Tomados en conjunto, estos resultados demuestran que el G 13 se requiere para la inhibición mediada por Nogo-A-Δ20 de la propagación celular y el crecimiento de neuritas in vitro.
Figura 5. Inhibición de Nogo-A-Δ20 está mediada a través del eje de señalización G 13 -LARG-R hoA y puede ser modulada por S1P exógeno.
(A) las células 3T3 transfectadas con siRNAs contra 12, G 13, G q, o Larg o control (ctrl) siRNA se volvieron a sembrar en un sustrato de Nogo-A-Δ20 y evaluados para la propagación de células. i / o fue bloqueado con toxina pertussis (PTX) para el que se utilizó una solución salina como control. JTE-013 se co-aplicada a las células tratadas con 13-G siRNA para investigar un efecto acumulativo. (B) La transfección de DIV4 E19 neuronas corticales con siRNA contra 13 G 12, pero no la inhibición de crecimiento de las neuritas inducido por Nogo-A-Δ20 similar rescatado. (C, D) la activación de RhoA inducida por Nogo-A-Δ20 se evaluó en células JTE-013-frente a tratados con DMSO (C) o en células que llevan una caída estable de S1PR2 (SH-S1pr2) frente al control del vector (SH-Vec ) (D). (E, F) Cuantificación relativa de (C) y (D), respectivamente. (G, H) cuantificaciones ELISA competitivas de extra-(CE) y el intracelular (IC) niveles de S1P en las células 3T3 (G) y las neuronas granulares de cerebelo (H) antes y después de los 30 y 60 minutos de incubación con Nogo-A-Δ20. (I) La cuantificación de la difusión de la inhibición mediada por células-Nogo-A-Δ20 en la presencia del bloqueador de SphK D-específica, L-treo-dihidroesfingosina (DHS) o en SPHK1 - / - o SphK2 - / - MEFs.(J, K) células 3T3 se sembraron sobre un sustrato de Nogo-A-Δ20 en la presencia de la función de bloqueo anti-S1P anticuerpo Sphingomab (J) o de S1P exógeno (K) y se evaluó para la propagación de células. La aplicación conjunta de JTE-013 invierte significativamente los efectos moduladores obtenidos por S1P (K) pero no anti-S1P (J).El anticuerpo anti-BrdU o metanol se utilizó como control en (J) y (K). Los datos mostrados son medias ± SEM (n = 3-6 experimentos, * p <0,05, ** p <0,01, *** p <0,001).
doi: 10.1371/journal.pbio.1001763.g005
S1PR2 se ha demostrado que a través de par T 12/13 a la RhoGEF LARG para mediar diversos efectos celulares RhoA-dependiente [30] . regulación a la baja de ARNsi mediada por células de LARG totalmente rescatado se extiende desde ~ 63% a ~ 103% en Nogo-A-Δ20 en comparación con el control de siRNA (p <0,01) ( Figuras 5A , S4C, y S4G ). Esto está en consonancia con la activación mediada por LARG de RhoA reportado para otras señales repulsivas como S1P (vía S1PR2 [30] ), semaphorin4D (vía PlexinB1 [31] ), y la molécula de orientación repulsiva RGMA (vía Unc5B [32] ).
Para probar si la activación de RhoA de Nogo-A-Δ20-inducida [22] , [33] se S1PR2-dependiente, se midió la actividad de RhoA endógena en el bloqueo o el silenciamiento de S1PR2 en células 3T3 ( Figura 5C-5F ). Bajo condiciones de control, se observó un aumento de ~ 2 veces en la activación de RhoA después de 20 min de incubación con Nogo-A-Δ20 (Figura 5C y 5D ). Tras la aplicación de JTE-013 ( Figura 5C y 5E ) o el silenciamiento de S1PR2 ( Figura 5D y 5F ), la activación de RhoA se suprimió completamente (p <0,05). Estos resultados sugieren que S1PR2 se requiere para la activación de RhoA inducida por Nogo-A-Δ20, más probablemente a través de una vía de señalización 13-LARG T.

Nogo-A-Δ20-Mediado Inhibición es modulada por Exógenos S1P

Para determinar las posibles interacciones funcionales de Nogo-A-Δ20 y S1P en el nivel de S1PR2, lo primero que investigó si misma de Nogo-A-Δ20 modula la producción de S1P.Extra-(CE) e intracelular (IC) niveles de S1P se cuantificaron en 3T3 y cerebelosas culturas gránulo neuronas después de un min de estimulación 30 y 60 con Nogo-A-Δ20 ( Figura 5G y 5H ). No se detectaron cambios significativos en comparación con los niveles de control, lo que indica que Nogo-A-Δ20 no tenía ninguna influencia sobre la producción de S1P en nuestras condiciones experimentales ( Figura 5G y 5H ).
A continuación, abordamos el papel de la endógena S1P en los efectos inhibitorios mediados por Nogo-A-Δ20. El bloqueo farmacológico de la S1P enzimas productoras de la esfingosina quinasa (SphK) 1 y 2 usando D, L-treo-dihidroesfingosina (DHS) [34] , [35] no tuvo ningún efecto sobre la inhibición mediada por Nogo-A-Δ20 de la propagación de células, lo que sugiere que SphKs no son elementos aguas abajo de la inhibición inducida por Nogo-A-Δ20 ( Figura 5I). Para confirmar este resultado, MEFs aisladas de SPHK1 - / - o SphK2 - / - ratones [36] se colocaron en placas sobre un sustrato de Nogo-A-Δ20. De manera similar al bloqueo SphK, no se observaron diferencias en la inhibición de la propagación de células ( Figura 5I ).
Debido a S1P se encuentra en el suero bovino fetal (FBS) medio que contiene [37] utilizado en nuestras condiciones experimentales, se investigó si S1P derivada del suero modula la inhibición mediada por Nogo-A-Δ20. Para este propósito, S1P extracelular se compactó usando el anticuerpo anti-S1P monoclonal Sphingomab [38] . Célula de análisis propagación reveló que la inhibición inducida por Nogo-A-Δ20 se alivió por ~ 28% ( p < 0,05) en la presencia del anticuerpo anti-S1P en comparación con el control anti-BrdU ( Figura 5J ). Para excluir que la desinhibición de la señalización de Nogo-A-Δ20 mediante el bloqueo o el silenciamiento S1PR2 está mediada por un aumento de la activación de acoplado-Rac1 S1PR1 través de S1P derivada del suero, anti-S1P se aplicó junto con JTE-013. No hay diferencias podrían ser observadas entre las células anti-S1P-y tratados con anti-BrdU en presencia de JTE-013 (Figura 5J ). Juntos, estos resultados sugieren que la inhibición mediada por S1PR2 por Nogo-A-Δ20 se produce independientemente de S1P pero que S1P puede modular los efectos mediados-Nogo-A-Δ20. De hecho, la adición de S1P a las células dio lugar a un ~ 31% ( p <0,001) y ~ 28% ( p <0,001) disminución de la inhibición de la propagación de células en un control y el sustrato de Nogo-A-Δ20, respectivamente, en comparación con el MeOH + control de DMSO ( Figura 5K ). Estos resultados apuntan a una función moduladora de S1P en la inhibición mediada por Nogo-A-Δ20 de propagación celular, presumiblemente mediante la activación de forma independiente S1PRs de la superficie celular acoplados a RhoA, por ejemplo, S1PR2. Concordantemente, S1P se ha descrito anteriormente para modular la adhesión celular y el crecimiento de diferentes tipos de células [18] , [27] , [39] . Para probar esta hipótesis, JTE-013 fue co-aplicada con S1P. La inhibición inducida por S1P-de la propagación de células podría ser revertido significativamente en un control y el sustrato de Nogo-A-Δ20 en presencia de JTE-013 ( p <0,001) ( Figura 5K ). Juntos, estos resultados indican que S1P puede modular la inhibición de la propagación de células mediada por Nogo-A-Δ20 a través de S1PR2. Sin embargo, también sugieren que Nogo-A-Δ20 actúa independientemente de SphK o S1P.

Nogo-A Restringe potenciación a largo plazo a través de S1PR2 en el hipocampo y la corteza de motor

La creciente evidencia sugiere que Nogo-A juega un papel importante en la restricción de plasticidad sináptica [6] , [9] , [11] . S1PR2 se expresa en las neuronas piramidales CA1 y CA3 ( Figura 1A y 1B ). Con el fin de investigar el papel del eje Nogo-A/S1PR2 en la potenciación a largo plazo (LTP), rebanadas de hipocampo de WT y de Nogo-A - / - ratones se ensayaron para determinar la LTP después del bloqueo agudo de S1PR2 usando JTE-013. En rodajas de WT, la aplicación de JTE-013 dio lugar a un aumento significativo en la LTP en comparación con vehículo (DMSO) (~ 22%; p < 0,05) ( Figura 6A ). En contraste, no se detectaron diferencias en la LTP en Nogo-A - / - rebanadas tratadas con JTE-013 o el vehículo, lo que sugiere que Nogo-A es necesaria para los efectos mediados-S1PR2 sobre LTP ( Figura 6B ). No hay diferencias en la entrada-salida (E / S) se curva y la facilitación a dos pulsos (PPF) se pudo observar por la aplicación de JTE-013, lo que sugiere que el bloqueo S1PR2 no altera la transmisión sináptica basal o las propiedades de los terminales presinápticos ( Figura 6C- 6F ). Con el fin de confirmar la especificidad de S1PR2, la LTP se midió después del bloqueo de los S1PRs restantes ( Figura S6A y S6B ). No hay diferencias en la LTP y PPF pudieron observarse tras la aplicación de VPC-23019 o FTY-720, haciendo hincapié en la especificidad de una interacción Nogo-A/S1PR2 funcional ( Figura S6A-S6C ). Continuación, se investigó LTP, la transmisión sináptica basal, así como PPF en S1PR2 - / - en comparación con WT rodajas de hipocampo. No hay cambios significativos en la LTP, I / O, o PPF se pudieron observar en S1PR2 - / - en comparación con los ratones WT ( Figura S6D-S6F ) en contraposición a la neutralización aguda de S1PR2. Estos resultados reflejan los obtenidos en Nogo-A KO [7] o NgR1 KO [8] y ratones sugieren que hay un fuerte impulso para la compensación genética en este funcionalmente muy importante del sistema. [11] .
Figura 6. El bloqueo de S1PR2 phenocopies el aumento en el hipocampo y cortical LTP observado en Nogo-A de neutralización.
(A, B) del hipocampo WT (A) y de Nogo-A - / - (B) rebanadas fueron tratados con JTE-013 o vehículo (DMSO) (WT DMSO : n = 8; Nogo-A - / - DMSO : n = 10; PESO JTE-013 : n = 11; Nogo-A - / - JTE-013 : n = 9). 60 minutos después de la estimulación theta-burst (flecha), una diferencia significativa en la LTP se pudo observar entre JTE-013 y el tratamiento de DMSO en WT (A), pero no de Nogo-A - / - (B) rodajas. (C, D) Resistencia de entrada-salida no reveló diferencias en JTE-013-frente a rodajas tratadas con DMSO de WT (C) y Nogo-A - / - (D) ratones (WT DMSO : n = 6; Nogo-A - / - DMSO : n = 6; PESOJTE-013 : N = 7; Nogo-A - / - JTE-013 : N = 6). (E, F) PPF no reveló alteraciones en JTE-013-en comparación con las rebanadas tratadas con DMSO de WT (E) y de Nogo-A - / -ratones (F) (WT DMSO : n = 7; Nogo-A - / - DMSO : n = 6; PESO JTE-013 : N = 5; Nogo-A - / - JTE-013 : N = 6). (G) LTP se midió la neutralización simultánea de S1PR2 usando JTE-013 y de Nogo-A utilizando 11C7 (IgG1 + DMSO: n = 7; IgG1 + JTE-013: N = 6; 11C7 + DMSO: n = 8; 11C7 + JTE-013: N = 6). (H) LTP se midió la neutralización simultánea de S1PR2 usando JTE-013 y de NgR1 usando anti-NgR1 (DMSO: n = 7; JTE-013: n = 9; anti-NgR1 + JTE-013: N = 8). (I) rebanadas área de la extremidad anterior del motor de cerebro de rata fueron tratados con JTE-013 ( n = 7) o DMSO ( n = 8). Amplitudes máximas fueron significativamente mayores en JTE-013 versus tratados con DMSO rodajas sobre inducciones repetidas de LTP (varias flechas). (J) la fuerza de entrada-salida no reveló diferencias en JTE-013-( n = 8) frente a tratado con DMSO ( n = 12) rodajas corticales. El recuadro muestra trazas representativas. Los datos mostrados son medias ± SEM (* p < 0,05). n indica el número de ratones utilizados.
doi: 10.1371/journal.pbio.1001763.g006
A continuación, el resultado de una neutralización combinado del ligando de Nogo-A de la función de bloqueo anti-Nogo-Un anticuerpo 11C7 [12] se analizó y del receptor S1PR2 por JTE-013. Un efecto sinérgico del tratamiento combinado en comparación con cualquier tratamiento solo indicaría que las moléculas adicionales, por ejemplo, S1P están involucrados en la restricción mediada LTP-S1PR2. Se observó un aumento similar en la LTP para todos los grupos tratados en comparación con el control de IgG1 + DMSO sin diferencia entre los grupos ( Figura 6G ). Para evaluar la contribución relativa de los receptores de Nogo-A NgR1 y S1PR2 en Nogo A-mediada por la restricción de la plasticidad sináptica, que bloquearon simultáneamente ambos receptores. No hay diferencia significativa se observó entre la aplicación de solo JTE-013 en comparación con la aplicación combinada de JTE-013 y de la anti-NgR1 función de bloqueo de anticuerpo ( Figura 6H ).
Por último, se investigó el efecto del bloqueo S1PR2 sobre la depresión a largo plazo (LTD) en el hipocampo. En línea con los resultados obtenidos después de Nogo-neutralización aguda [7], la aplicación JTE-013 ni hizo modular la inducción LTD ni mantenimiento en comparación con las condiciones de control ( Figura S6G ).
Datos recientes indican que Nogo-A también restringe la plasticidad sináptica en la corteza motora primaria [11] . Saturación de LTP en esta región también se incrementó significativamente en JTE-013 frente a rodajas tratadas con DMSO (~ 39%; p < 0,001) ( Figura 6I ). No se observaron diferencias en las curvas de E / S después del bloqueo S1PR2, lo que indica que el aumento mediado por JTE-013 en la plasticidad sináptica no se debe a alteraciones en la transmisión sináptica basal ( Figura 6J ). Juntos, estos resultados muestran que Nogo-A reprime la plasticidad sináptica en el hipocampo y la corteza motora a través de S1PR2.

Discusión

Dos dominios distintos de Nogo-A pueden inducir la inhibición del crecimiento: Nogo-A-Δ20 y Nogo-66. Aquí, hemos identificado el GPCR S1PR2 como el primer receptor funcional para el dominio Δ20 inhibidora de Nogo-A. S1PR2 cumple criterios clave esenciales para ser un receptor-Δ20-específica de Nogo-A: (i) Expresión en el SNC así como en A-Nogo-Δ20-sensibles las células no neuronales, (ii) la unión de alta afinidad a Nogo- Un Δ20-; (iii) un requisito previo para la inhibición inducida por Nogo-A-Δ20 de la propagación de células y el crecimiento de neuritas, (iv) inducida por la activación de Nogo-A-Δ20 de RhoA, (v) la restricción de hipocampo y la plasticidad sináptica cortical.

S1PR2 es un receptor para un lípido y una proteína ligando

Hasta hace muy poco, los GPCR se piensa generalmente para ser activado por MW estímulos químicos físicos y bajas [40] . Sin embargo, se encontraron unos GPCRs adhesión de obligar también a los ligandos unidos a la membrana y de la matriz a través de una extensa región N-terminal [41] , [42] . Muchos de estos receptores, tales como CD97 que contiene EGF, el primero de GPCR demostrado que se unen al factor acelerador de la degradación ligando celular, se expresan predominantemente por células inmunes [43] . Para nuestro conocimiento, Nogo-A es la primera proteína de membrana de mamífero demostrado que se unen a y señal a través de un GPCR no huérfano de la familia-rodopsina similares. En contraste con los GPCR de adhesión, S1PR2 no se une de Nogo-A-Δ20 a través de su dominio N-terminal.
La reciente caracterización de la estructura cristalina de S1PR1 proporcionado información estructural sustancial en su activación por S1P [19] . Acceso del ligando al bolsillo de unión desde el espacio extracelular se ocluye por el extremo N-terminal y el LCE, y puede ser adquirida desde el interior de la membrana [19] . Nuestros datos proporcionan una fuerte evidencia de que Nogo-A-Δ20 interactúa principalmente con ECL2 y ECL3 de S1PR2, lo que sugiere un mecanismo diferente de activación en comparación con S1P. Nuestros resultados también sugieren que la inhibición mediada por S1PR2 de Nogo-A-Δ20 no requiere S1P pero puede ser exógena modulada por este último. Aunque la unión de Nogo-A-Δ20 a S1PR2 no requiere S1P, la modulación de salidas fisiológicos específicos del receptor por la unión del lípido bioactivo a su bolsillo dentro de la membrana puede ampliar aún más el repertorio de señalización de S1PR2. También puede permitir respuestas celulares afinado dependiendo de la relación de ligandos presentes en determinadas condiciones, como sugerido recientemente para el receptor para productos finales de glicación avanzada (RAGE) [44] . Será necesario abordar esta estudios bioquímicos y estructurales futuros y mostrar cómo la unión se transfiere a la señalización de la proteína G-dependiente de ligando específico. Investigaciones detalladas también tendrán que determinar si la presencia de receptores adicionales, es decir, NgR1, afecta a las propiedades de unión de Nogo-A-Δ20 a S1PR2 como se describe para otros sistemas multi-receptor, por ejemplo, la glucoproteína de superficie viral gp120 a CD4 y el GPCR co-receptor CCR5 [45] . Hemos podido demostrar que Nogo-A interactúa con S1PR2 en trans . Sin embargo, la interacción en la superficie de la misma célula en cis también podría ser posible, similar a lo que se ha propuesto para la interacción de Nogo-A-NgR1 en las células de Purkinje recientemente [46] . Sin embargo, estos mecanismos no han sido probados y su existencia tiene que ser investigado en detalle.

Multi-ligand/Multi-receptor Cross-Talk

El clásico paradigma "un ligando y un receptor" ha sido recientemente cuestionado por un creciente número de interacciones multi-ligand/multi-receptor, lo que podría ser identificado en diferentes sistemas biológicos, agregando otro nivel de complejidad para el perfeccionamiento de las respuestas celulares [ 20] . Los ejemplos incluyen los receptores de neurotrofinas, receptores de Wnt, y los receptores para las moléculas de guía axonal tales como plexins y neuropilins [20] . Proponemos que el dominio Δ20 de Nogo-A se une a S1PR2 y el bucle de Nogo-66 a NgR1 y / o PirB, resultando en la formación de un complejo receptor multi-site/multi-ligand. NgR1 y PirB también pueden interactuar con ligandos distintos de Nogo-A, aumentando de este modo la dinámica de la transducción de señales [6] , [9] . Adicional Nogo-A co-receptores y componentes de señalización corriente abajo potencialmente ubicados dentro o vinculados a estos complejos de múltiples receptores de podría amplificar aún más Nogo-A mediada efectos inhibitorios. Se ha demostrado recientemente que la señalización de GPCR canónica también se produce a partir de endosomas para, por ejemplo, el receptor Frizzled de Wnt [47] y la β2-adrenérgicos [48] . En esta línea, el complejo Nogo-A-Δ20/S1PR2 es co-internaliza en endosomas, de las que la señalización puede ser sostenida. En la actualidad, la acción concertada y la trata de aguas abajo de todos estos componentes del receptor aún es poco conocido, en particular, en vivo . Necesitarán estudios futuros para evaluar si todos los (co-), los receptores de Nogo-A se encuentran en el mismo complejo o en diferentes microdominios de membrana, y cómo la composición del receptor varía entre diferentes tipos de células, etapas de desarrollo, y condiciones fisiopatológicas.

Interferir con Nogo-A/S1PR2 Señalización Aumenta plasticidad sináptica

Nogo-A estabiliza redes neuronales mediante la restricción de plasticidad del SNC [2] , [9] .Neutralización aguda de Nogo-A o NgR1 en rebanadas de hipocampo fue mostrado para inducir un aumento en la LTP en las sinapsis CA3-CA1 [7] . Por otro lado, nocauts convencionales de Nogo-A, PirB o NgR1 no muestran modulaciones significativas en LTP, presumiblemente debido a los mecanismos de compensación [7] , [8] , [10] , [11] , [49] . Esto está en sintonía con la falta de LTP modulación observada en S1PR2 - / - ratones. Un nuevo modelo de rata transgénica en la que se silenció de Nogo-A expresión, pero no completamente ablación mediante el uso de un sintética anti-Nogo-A microARN dejando el locus genómico intacto mostró un aumento significativo en la LTP en el hipocampo, así como en la corteza motora [11 ] . Esto pone de relieve el fuerte impulso para la compensación genética después de la ablación completa de los componentes dentro de este funcionalmente muy importante del sistema. Nuestros resultados actuales revelan un aumento en el hipocampo y la corteza LTP cuando interfiere gravemente con la señalización S1PR2 por JTE-013. En particular, no se observó aumento mediada por JTE-013 en LTP en el hipocampo de Nogo-A - / - ratones, subrayando el papel plasticidad de restricción de Nogo-A/S1PR2 de señalización independiente de S1P. De hecho, CA3-CA1 LTP ha demostrado ser independiente de SphK/S1P la señalización del receptor [50] . Curiosamente, el bloqueo de ambos receptores de Nogo-A NgR1 y S1PR2 no muestra un efecto aditivo sobre la LTP potenciación, lo que sugiere que ambas respuestas del receptor-evocado inducidas por diferentes dominios de Nogo-A convergen en las mismas vías de señalización. Sin embargo, los mecanismos detallados y la cinética por el cual Nogo-A/S1PR2-NgR1 modifican la plasticidad sináptica permanecen para ser analizadas.

Conclusión

Nuestro hallazgo de que el GPCR S1PR2 une a dos moléculas estructuralmente no relacionados, un esfingolípido MW baja y la proteína de la membrana MW alta Nogo-A, por sitios distintos contribuye y amplía el cambio de paradigma de un modelo lineal clásico de señalización de GPCR hacia un modelo más dinámico con componentes compartidos y conversaciones cruzadas intramoleculares [51] , [52] . Será importante comprender en qué medida S1P afectos señalización inducida por Nogo-A y viceversa. Se requerirá de alta resolución caracterización estructural detallada del receptor en el complejo con S1P, Nogo-A, o ambos para desentrañar las propiedades mecánicas de estos dos sistemas de señalización.Además, la interacción específica de la célula de S1PR2 con receptores conocidos y co-receptores para Nogo-A se debe determinar en detalle con respecto a sus efectos fisiológicos correspondientes. Esta información será la base para el diseño de nuevas herramientas moleculares para comprender mejor el papel de los Nogo-A/S1PR2 de señalización para la plasticidad y la reparación del SNC.

Materiales y Métodos

Animales

Todos los experimentos con animales se realizaron con la aprobación y en estricta conformidad con las directrices de la Oficina Veterinaria Cantonal de Zúrich. Se hicieron todos los esfuerzos para minimizar el sufrimiento de los animales y reducir el número de animales necesarios.
S1pr2 - / - (B6.129S6-S1pr2 tm1Rlp ) ratones fueron producidos por mutagénesis dirigida a lo descrito previamente [28] y backcrossed a C57BL / 6 de fondo.

Números de Acceso Ensembl

Adhesión números mencionados en este artículo de la Ensembl Genome Browser (www.ensembl.org ) son: Gna12 , ENSMUSG00000000149; Gna13 , ENSMUSG00000020611;Larg , ENSMUSG00000059495; RhoA , ENSMUSG00000007815; Rtn4 , ENSMUSG00000020458, ENSRNOG00000004621; S1pr2 , ENSMUSG00000043895.

La levadura de dos híbridos de pantalla

La proteína recombinante de Nogo-A-Δ20 fusionado al dominio de activación del factor de transcripción GAL4 se utilizó como cebo para la detección de las proteínas que interactúan a partir de ADNc de adultos y bibliotecas de cerebro fetal (Clontech) usando el método (Y2H) levadura de dos híbridos como se describe previamente [53] . Brevemente, el fragmento de cebo de codificación de cDNA se generó mediante PCR, clonado en pDONR201, y se transfirió a Gateway (Invitrogen) versiones compatibles-de pGBT9 por la reacción LR. La cepa de levadura CG1945 (Clontech) se transformó con el vector resultante. bibliotecas de cDNA se transformaron en la cepa Y187 (Clontech). Cebo y presa levaduras que expresan se aparearon en YPDA en presencia de 10% de polietilenglicol 6000. El medio se cambió a medio selectivo (dextrosa sintética) que carecen de Leu, Trp, y Su con los siguientes aditivos: 0,5% de penicilina / estreptomicina (50 mg / ml, Invitrogen), 50 micras 4-metilumbeliferil-α-D-galactósido (Sigma) , y concentraciones variables de 3-amino-1, 2, 4-triazol (3-AT, Sigma). Diferentes concentraciones de 3-AT fueron probados en los pre-pantallas, variando de 0-60 mM. 60 mM 3-AT produjo <20% hits, 130 mM 3-AT fue utilizado en la pantalla principal, lo que resulta en ~ 0,5% interacciones fuertes cebo y presa. Eficiencia de acoplamiento se determinó por siembra de las células sobre placas de agar selectivas. La suspensión celular se dividió en alícuotas en placas de microtitulación (96 pocillos / placa, de fondo plano, 200 l / pocillo) y se incubaron durante 3-7 días. Los clones positivos fueron seleccionados mediante la determinación de la fluorescencia en un fluorómetro SpectraFluor (Tecan) a 465 nm (excitación a 360 nm). Los pozos que muestran fluorescencia por encima del fondo fueron identificados y recogidos automáticamente por un robot Tecan Génesis 200. Las células seleccionadas se pasaron dos veces y se transfirieron a una placa de agar antes de la amplificación por PCR de los insertos de la biblioteca. Después de la secuenciación del ADN y la secuencia de voladura, todas las interacciones de cebo y presa fueron evaluados para promiscuidades presa intrínsecas en comparación con las bases de datos que contienen información de la casa presa en las frecuencias de enlace obtenidos en estudios anteriores [53] . Ingenuity Pathway Analysis (IPA, Ingenuity Systems) se utilizó posteriormente para determinar si la señal de compañeros de interacción a través de RhoA.

Preparación de tejidos y cultivo celular

Total de extractos de proteínas de mielina se preparan a partir de los cerebros y las médulas espinales de ratas Wistar adultas a lo descrito previamente [12] . Swiss 3T3 (ATCC), células NIH 3T3 (ATCC), y células HEK293T (ATCC) se mantuvieron en DMEM que contenía suero de ternero recién nacido al 10% (Invitrogen). Postnatal (P5-8), las neuronas granulares de cerebelo se prepararon como se describe anteriormente [12] . Día embrionario (E) se prepararon 19 neuronas corticales de rata como se describe anteriormente [8] . Se aislaron y se inmortalizan como se describió previamente MEFs primarios [54] . Cada cultivo de fibroblastos primario se aisló de una sola E9.5 S1pr2 - / - o PESO camada ratón.

siRNA, shRNA y proteínas de fusión recombinantes

S1PR2 (ENST00000317726) se amplificó por PCR a partir de ARN-sangre humana, clonado en los sitios EcoRI / Xho del vector pcDNA5 (Invitrogen) y se secuenció completamente. Las secuencias de ratón de los siRNAs utilizados sc-41801 (Santa Cruz de Biotecnología). Las secuencias de rata son 12 ON-TARGETplus siRNA SmartPool L-088001-02-0005 (Thermo Scientific) y 13 ON-TARGETplus siRNA SmartPool L-086608-02-0005 (Thermo Scientific).Una secuencia de ARNsi revueltos se utilizó como control (Dharmacon). Células NIH 3T3 fueron transfectadas utilizando Lipofectamine LTX de acuerdo con las instrucciones del fabricante (Invitrogen). E19 neuronas corticales fueron transfectadas en días in vitro (DIV) 4 usando DharmaFECT 3 (Dharmacon) de acuerdo con las instrucciones del fabricante.Cuantificación del ARNm respectivo caída se realizó mediante qRT-PCR. La cuantificación de la caída de proteína se realizó por análisis de FACS.
Silencios de S1pr2 mediante transducción retroviral de construcciones shRNA se realizó mediante el uso de phoenix-helper gratuita líneas productoras de retrovirus con psir delta HRCG U6 para la generación de los retrovirus-helper libre como se describe a continuación [55]. La siguiente construcción shRNA dirigido S1pr2 se utilizó mRNA transcripción:ACCAAGGAGACGCTGGACATG [56] . Vector vacío se utilizó como control. Cuantificación del ARNm respectivo caída se realizó mediante qRT-PCR. La cuantificación de la caída de proteína se realizó por análisis de FACS.
La proteína recombinante de Nogo-A-Δ20 (rata aa544-725) se purificó como se describe anteriormente [12] . Brevemente, BL21/DE3 de Escherichia coli se transformaron con el vector de expresión pET28 (Novagen) que contiene His-/T7- o His-/HA-tagged de Nogo-A-Δ20 y se cultivaron a 37 ° C para alcanzar una DO de 0,6 UA. La expresión de proteínas se indujo mediante la adición de 1 M de IPTG durante 2 h a 30 º C. Las proteínas de fusión se purificaron utilizando Co 2 + -Talon metal Affinity Resin (Takara Bio Inc.). Nogo-A-ext fue clonado (rata aa1-979) en los sitios de restricción KpnI y XhoI del vector de expresión pEXPR-IBA5 y la proteína recombinante se purificó a partir de células HEK293T transfectadas transitoriamente utilizandoStrep -Tactin cromatografía (IBA).

QRT-PCR

ARN se aisló con RNeasy Micro Kit (Qiagen). Para la síntesis de ADNc se utilizó la transcriptasa inversa Superscript III (Invitrogen). QRT-PCR se realizó como se ha descrito antes de utilizar el sistema LightCycler 480 (Roche, [57] ). Para determinar la expresión relativa de los genes diana Gna12 , Gna13 , GNAQ , Larg y S1pr2 utilizamos Tubb1 y EEF1A1como genes de limpieza. Se utilizaron los siguientes cebadores: Gna12_FWD: 5'-CATGCGATGCTGCTAAGCTCAC-3 ' , Gna12_REV: 5'-TGTGTGTTCACTCTGGGAGGTG-3 ' ; Gna13_FWD: 5'-ACTAACCGTGCCTCTTCAATGGC-3 ' , Gna13_REV: 5'-AGGCACCCAACAAGAACACACTG-3 ' ; Gnaq_FWD: 5 ' -TGGGGACAGGGGAGAG-3 ' , Gnaq_REV: 5'-TGGATTCTCAAAAGCAGACAC-3 ' ; S1pr2_FWD: 5'-CACAGCCAACAGTCTCCAAA-3 ' , S1pr2_REV: 5'-TGTTCCAGAACCTTCTCAGGA-3 ' ; Larg_FWD: 5'-GAATCATCAAGGTGAATGG-3 ' , Larg_REV: 5 ' -CTGGTGATTCTCTCCATATTC-3 ' ; Tubb1_FWD: 5'-GCAGTGCGGCAACCAGAT-3 ' , Tubb1_REV: 5'-AGTGGGATCAATGCCATGCT-3 ' ; Eef1a1_FWD: 5'-TCCACTTGGTCGCTTTGCT-3 ' , Eef1a1_REV: 5'-CTTCTTGTCCACAGCTTTGATGA-3 ' .
Se analizaron todas las muestras por triplicado. Se realizó análisis de la curva de fusión de los productos PCR seguido por electroforesis en gel para verificar la amplicones.

Los anticuerpos y farmacológicas Bloqueadores

Se utilizaron los siguientes anticuerpos primarios: β tubulina (Chemicon, MAB3408; 1:1.000), βIII tubulina (Promega, G712A; 1:1.000), β-actina (Sigma, A5441; 1:1.000), BrdU (ABD Serotec, función experimentos de bloqueo: 5 mg / ml), DAPI (Invitrogen, D1306, 1:1.000), EEA1 (Señalización Cell, 2411; 1:100), GAPDH (Abcam, ab8245; 1:20.000), HA (Roche, 11867423001, 1:200), Su (Santa Cruz, sc-804, 1:500), Pan-CDH (Abcam, ab6528; 1:1.000), Nogo-A (1:10.000, [58] ), Nogo-A (Rb173A / Laura, 1:200), Nogo-A / B (Bianca, Rb1, 1: 20 000,[12] ), Phalloidin-Alexa488 (Invitrogen; 1:500), RhoA (Cell Signaling, 2117; 1:1.000), S1PR2 (Imgenex, IMG-6135A; 1:250), S1PR2 (AbD Serotec encargo AbD14533.1 anticuerpo HuCAL abordar extracelular S1PR2 ECL2; WB 1:1.000; IHC 1:100; 1:100 TEM), S1PR2 (Santa Cruz, SC-365589; 1:500), S1PR5 (Abcam, ab13130; 1:500; función de bloqueo de experimentos: 5 g / ml), la esfingosina 1-fosfato (Funakoshi, 274,594,052; función-experimentos de bloqueo: 5 mg / mL), La ubiquitina (Enzo Life Sciences, UWO150; 1:1.000).
Se usaron los siguientes anticuerpos secundarios: cabra Alexa488-conjugado anti-IgG de ratón (Invitrogen; 1:1.000), de cabra conjugado con Alexa488 anti-IgG de conejo (Invitrogen; 1:1.000), de cabra Alexa488-conjugado anti-IgG de rata (Invitrogen; 1:1.000), biotina-SP AffiniPure conjugado de cabra anti-IgG de conejo (Jackson ImmunoResearch Laboratories; 1:250), biotina-SP AffiniPure conjugado de cabra anti-IgG humana F (ab ') 2 fragmento específico (Jackson ImmunoResearch Laboratories; 1: 250), la estreptavidina conjugada con Cy3 (Jackson ImmunoResearch Laboratories; 1:500), Cy5 de cabra anti-conejo (Invitrogen; 1:500), de cabra conjugado con FITC anti-humano IgG (Fab específico; AbD Serotec), de cabra conjugado con HRP anti-IgG humana (específica de Fab; AbD Serotec), de cabra conjugado con HRP de IgG anti-conejo (Fab específico; Amersham), de cabra conjugado con HRP anti-ratón IgG (Fab específico; Amersham),
Los siguientes bloqueadores farmacológicos utilizados en este estudio se han disuelto de acuerdo con las instrucciones del fabricante: W146 (Avanti Polar Lipids), VPC-23019 (Avanti Polar Lipids), JTE-013 (Tocris Bioscience), FTY-720 (Cayman Chemical), y DHS (Ciencias de la Vida de Enzo). Nogo-66 fue adquirido de R & D Systems. La esfingosina-1-fosfato y agrecano se adquirieron de Sigma.

Los ensayos de unión

Ensayos de unión a base de inmovilización se realizaron en un instrumento Red Octeto ( fortéBIO). Recombinante S1PR2 y preparaciones de membrana de control (Millipore) se inmovilizaron sobre biosensores reactivos con amina (25 mg / ml; Forte O) en HBSN funcionamiento de amortiguación (BIAcore) suplementado con 10 mM MgCl 2 . Proteína Nogo-A-ext se diluyó en serie y deja que se una la punta de biosensores saturados durante 15 min a 1000 rpm a 30 º C. Para los experimentos incluyendo S1P, se añadió 1 M de S1P junto con Nogo-A-ext. El metanol se utiliza como control de vehículo. La respuesta de unión se normalizó para líneas base diferencias entre carreras y afinidades de unión ( D ) se calcula a partir de un ajuste no lineal de acuerdo con el método de sustracción de doble referencia en GraphPad Prism5 (el software GraphPad). Los datos mostrados son el promedio de tres a cinco experimentos por condición.
Mediciones de unión de ligando termoforesis microescala se realizaron utilizando un Nanotemper Monolito NT.115 (tecnologías Temper Nano) como se ha descrito previamente [59][60] . En pocas palabras, recombinante Nogo-A-Δ20 fue etiquetado con fluorescencia utilizando el reactivo RED Amina equipo de marcaje de proteínas (L001, tecnologías Temper Nano). La N-terminal y ECLs individuales de S1PR2 fueron sintetizados como péptidos (JPT Péptido Technologies, secuencias: N-terminal,MGGLYSEYLNPEKVQEHYNYTKETLDMQETPSRK ; ECL1, LSGHVTLSLTPVQW ; ECL2,NCLNQLEACSTVLPLYAKHYVL ; ECL3, SILLLDSTCPVRACPVLYK ; de control negativo revueltos-ECL1, VGLSQVWTSLPTLH ). Una concentración constante de Nogo-A-Δ20 (~ 40 nM) se incubó con los diferentes péptidos diluidos en serie en PBS que contenía 0,025% de Tween-20 a pH 7,4. 3-5 l de cada muestra se cargó en un capilar de vidrio hidrofílico (K004, tecnologías Temper Nano) y se realizó el análisis termoforesis (LED 60%, del laser IR de 20%)[59] , [60] . Datos del MST se normalizaron las diferencias iniciales entre carreras y Dvalores se calcularon mediante regresión no lineal asumiendo un coeficiente de Hill de 1.0 (GraphPad Prism).
La inmunoprecipitación se realizó con Nogo-A-Δ20 y preparaciones de membrana S1PR2 utilizando el kit de Pull-Down Su interacción de proteínas, siguiendo las instrucciones del fabricante (Pierce). Se utilizó inactivado por calor de Nogo-A-Δ20 como control.
Co-inmunoprecipitación se realizó utilizando todo el tejido cerebral de ratón a partir de P10 de Nogo-A - / - , S1PR2 - / - , y los ratones WT. Brevemente, el tejido se lisaron con tampón RIPA (Tris-HCl 50 [pH 7,2], NaCl 150 mM, 0,1% de SDS, 0,5% Na.Deoxycholate, 1% de NP-40) que contiene completar Mini tabletas EDTA-libre de cóctel inhibidor de proteasa ( Roche). Co-inmunoprecipitación se realizó usando el kit de Pierce Co-IP (Pierce 26149) de acuerdo con las instrucciones del fabricante.

En Vitro bioensayos

3T3 de fibroblastos difundir ensayos y neuronas P5-8 cerebelosa gránulo ensayos de desarrollo de neuritas se realizaron a lo descrito previamente [12] . Brevemente, las placas de cuatro pocillos (Greiner) se recubrieron con 40 pmol / cm 2 de Nogo-A-Δ20 o 5 mg / cm 2 de mielina a 4 ° C durante la noche. Nogo-66 Fc se utiliza a una concentración de 500 nM y Aggrecan a 1000 ng / ml. En experimentos de excrecencia, los pocillos se recubrieron previamente con 0,3 g / ml durante 1 hora a 37 ° C antes de la adición de los diferentes sustratos. Células 3T3 se sembraron a 7000 células por cm 2 durante 1 hora a 37 ° C y 5% de CO 2 , fijadas con 4% de paraformaldehído (PFA) y teñidas con faloidina-Alexa-488. Ratón neuronas P5-8 cerebelosa gránulo se sembraron a 7,5 × 10 4 células por cm 2 , se cultivaron durante 24 horas a 37 ° C y 5% de CO 2 , se fijaron con PFA al 4% y se tiñeron con anti-βIII tubulina. Cada experimento se realizó al menos tres veces en cuatro pocillos replicados. Difundir se cuantificó manualmente en una forma ciega y la longitud media de las neuritas se cuantificó usando el software MetaMorph (Molecular Devices). La longitud media de las neuritas se conoce como la longitud total media de todas las neuritas por célula. Células 3T3 fueron clasificados como células propagación, siempre que lleven al menos dos procesos lammelipodial más de un cuerpo celular de diámetro. Células redondas fueron clasificados como no-propagación. Los datos se normalizaron a la línea de base y se representan como media ± error estándar de la media (SEM). Las celdas eran imágenes con un microscopio Leica DM5500B equipado con HCX PL FL Dry 10 × / 0,3 y 20 × / 0,5 objetivos de una manera semi-automática. El análisis estadístico se realizó en GraphPad Prism5 usando una prueba de ANOVA de una vía seguida de una Bonferroni post hoc prueba o usando la prueba t de Student para datos independientes una.Todos los inhibidores se utilizaron a una concentración de 100 nM si no se especifica en otra parte.

Internalización Ensayos y Análisis de citometría de flujo

Las membranas plasmáticas de las células 3T3 se prepararon como se ha descrito antes [61]y después del tratamiento con 1 mM de T7-etiquetados de Nogo-A-Δ20. Ensayos de internalización de Nogo-A-Δ20 se realizaron como se ha descrito anteriormente después del tratamiento de células 3T3 con 1 M marcada con HA de Nogo-A-Δ20 [22] . Brevemente, las células 3T3 se incubaron con 1 M de Nogo-A-Δ20 durante 1 h en hielo (pulso) y posteriormente perseguido durante 15 y 30 min a 37 ° C. Flujo cuantificación basada citometría de S1PR2, G13, y la expresión LARG en células 3T3 y CGCs, respectivamente, se hizo en un BD FACSCalibur.

Ensayo Ubiquitination

Células 3T3 se mueren de inanición en medio libre de suero durante 24 h. 1 M de S1P o de Nogo-A-Δ20, respectivamente, se añadieron a células 3T3 durante 60 min. Aislamiento de fracciones proteicas ubiquitinadas se hizo utilizando UbiCapture-Q (Ciencias de la Vida de Enzo). Por último, se realizó un análisis de transferencia de Western para detectar S1PR2 y ubiquitina.

RhoA Pulldown

Células 3T3 se privaron de suero-durante la noche y se trataron durante 20 minutos con 1 M de Nogo-A-Δ20 o proteína de control de Nogo-A-Δ20-inactivado por calor. Pulldown de RhoA-GTP activado Posteriormente se realizó utilizando el Kit de Ensayo de activación de RhoA Biochem de acuerdo con las instrucciones del fabricante (citoesqueleto, Inc.).

Cuantificación S1P

Células 3T3 o CGCs se cultivaron hasta 80% -85% de confluencia en placas de 15 cm y se privaron de suero durante 24 h antes del experimento. Nogo-A-Δ20 se añadió a las células a una concentración de 1 mM. Después de 15, 30, y 60 min, las células 3T3 y CGCs se lisaron en 400 l de tampón de lisis (TUBOS 20 mM, NaCl 150 mM, EGTA 1 mM, 1% v / v de Triton X-100, 1,5 mM de MgCl 2 , pH 7,4 ). Los lisados ​​se congelaron inmediatamente a -80 ° C. La concentración de proteína se midió y los lisados ​​celulares (1:10 en suero humano deslipidizada) se analizaron con el kit de Echelon S1P ELISA de acuerdo con las instrucciones del fabricante. Medio de cultivo celular libre de suero fue directamente diluyó 1:10 en suero humano deslipidizada y posteriormente analizada con el kit de ELISA de S1P.

La inmunohistoquímica

La inmunohistoquímica se realizó a lo descrito previamente [62] . Brevemente, los animales fueron perfundidos transcardialmente con solución de Ringer, seguido de PFA al 4%. Antes de la tinción, las secciones se trataron con 0,2% de glutaraldehído y 50 mM de Tris-glicina (pH 8,0). Después de la recuperación de antígeno a través de microondas tres veces durante 10 s a 600 W, las secciones se trataron con Kryofix (Merck) durante 10 min seguido de 0,3% de Triton X-100 durante 10 min. S1PR2 se detectó con AbD14533.1 y secundaria de anticuerpos correspondientes.
Células 3T3 y CGCs se fijaron con PFA al 4% durante 15 min, se lavaron, y se permeabilizaron con 0,1% de Triton X-100. Después de bloquear con 2% de suero de cabra, las células se incubaron primero con AbD14533.1 y detectado usando conjugado de estreptavidina-Cy3.
Para la detección inmunocitoquímica de la superficie celular de S1PR2, las células 3T3 se incubaron con 50 g / ml AbD14533.1 en medio libre de suero que contiene 0,02% de azida de sodio durante 20 min en hielo. Las células se lavaron y se fijaron con 0,5% de PFA. Después del bloqueo (suero de ternera fetal al 4%, 2% de suero de caballo, 0,1% de gelatina de pescado de agua fría, 0,1% de caseína) en hielo, las células se incubaron primero con biotina de cabra anti-IgG humana, de conejo biotinilado anti-cabra, y, finalmente, con-Cy3 conjugado estreptavidina.

Electrofisiología

Hippocampus.
Cortes de hipocampo agudos se prepararon 40 a 60 días de edad (P40-P60) WT ratones C57BL / 6 o de Nogo-A - / - ratones de acuerdo con procedimientos estándar. En resumen, los ratones se anestesiaron y se decapitaron; el cerebro se transfirió rápidamente en carbogenated enfriado con hielo (95% de O 2 , 5% de CO 2 ) de fluido cerebroespinal artificial (ACSF).Hipocampos se cortaron con un vibratomo (400 micras; VT 1000S; Leica). La ACSF utilizado para grabaciones electrofisiológicas contenía NaCl 125 mM, 2 mM de KCl, 1,25 mM de NaH 2PO 4 , 1 mM de MgCl 2 , 26 mM NaHCO 3 , 2 mM CaCl 2 , glucosa 25 mM. Las grabaciones se realizaron a 32 ° C.
El bloqueo de S1PR2 se logró por incubación de las rebanadas de agudos con JTE-013, el bloqueo de S1PR1, 3, 4, 5 con FTY-720 y el bloqueo de S1PR1, 3 con VPC-23019, respectivamente. Los inhibidores se disolvieron en DMSO y recién añadido a una concentración final de 5 mM, 1 mM, y 0,1 mM, respectivamente, a la ACSF carbogenated. La concentración total de DMSO en la ACSF se mantuvo a 0,01%. Como se añadió DMSO de control solo. Con el fin de comparar los datos con un tubo de experimentos anteriores de silicio fue utilizado, y pre-se lava con ACSF que contiene BSA (0,1 mg / ml). Las rodajas se pre-incubaron durante 1 h (o 10 min para los experimentos en los que se combinaron JTE-013 y 11C7) con el inhibidor o DMSO como control en una cámara de incubación el mantenimiento de un flujo constante de la solución. Durante los experimentos, el inhibidor también estaba cerca. Para los registros electrofisiológicos, la tasa de perfusión en la cámara de grabación se mantiene constante en 1,5 ml / min.
Después de colocar las rodajas en un campo cámara de grabación sumergida, los potenciales postsinápticos excitatorios (fEPSPs) se registraron en el estrato radiado de la región CA1 con una micropipeta de vidrio (resistencia 3-15 MΩ lleno de 3 M de NaCl a una profundidad de ~ 100 micras. electrodos de tungsteno monopolares se utilizaron para la estimulación de las colaterales de Schaffer a una frecuencia de 0,1 Hz. La estimulación se ajusta para provocar una fEPSP con una pendiente de ~ 40% -50% de la máxima de las grabaciones de LTP. Después de 20 min de estimulación de línea de base de LTP fue inducida mediante la aplicación de estimulación de ráfaga theta (TBS), en la que una ráfaga consistió de cuatro pulsos a 100 Hz. Estos se repitieron 10 veces en intervalos de 200 ms (5 Hz). Tres de estos trenes se utilizaron para inducir LTP en 0,1 Hz. transmisión sináptica básica y propiedades presinápticas se analizaron a través de mediciones de E / S y la facilitación pares de pulso. Las mediciones de E / S se llevaron a cabo ya sea por aplicación de un valor definido de la corriente (25-250 μA en pasos de 25 μA) o mediante el ajuste de la intensidad del estímulo para un cierto actual provocar una volea de fibra (FV) de la tensión deseada. facilitación a dos pulsos se llevó a cabo mediante la aplicación de un par de dos estímulos en diferentes intervalos inter-estímulo (ISIS), que van desde 10, 20, 40, y 80 a 160 ms. Datos se recogieron, se almacena, y se analizaron con el software LabVIEW (National Instruments). La pendiente inicial de fEPSPs provocados por la estimulación de las colaterales de Schaffer se midió con el tiempo, normalizado a la línea de base, y se representa como media ± SEM.
Corteza motora.
Para las mediciones de LTP en la corteza motora [11] , cortes coronales que contienen la extremidad anterior son de M1 (1-2 mm anterior al bregma [63] ), y se prepararon a partir ratas adultas Sprague Dawley (180-220 g). JTE-013 concentraciones se utilizaron de acuerdo a los protocolos utilizados para cortes de hipocampo y se añade a la ACSF: NaCl 126 mM, 3 mM de KCl, 1,25 mM de NaH 2 PO 4 , 26 mM NaHCO 3 , 1 mM MgSO 4 , 2 mM CaCl 2 , y glucosa 10 mM, burbujea con un 95% de O 2 , 5% de CO 2 mezcla a 33 ± 0,5 ° C). Para permitir una óptima JTE-013 de penetración, las respuestas se graban desde el superface rebanada de la capa II / III en M1. Transmisión sináptica Básica se analizaron con análisis de E / S. E / S de las mediciones se llevaron a cabo mediante la aplicación de un valor de la corriente, lo que provocó una mínima (umbral) respuesta evocada (0,2-0,3 mV). E / S de las curvas se obtuvieron promediando de campo posibles amplitudes de pico de tres respuestas a los estímulos de dos, tres, cuatro, y cinco veces el umbral de respuesta. A fin de obtener la amplitud máxima que podrían ser evocados, se utilizó una intensidad de estimulación de 25 × umbral [64] , [65] . Para las mediciones de línea de base, la intensidad del estímulo se ajustó para producir respuestas 40% -50% de la amplitud máxima. Para el análisis de datos, se calculó la amplitud de la respuesta potencial de campo, ya que sirve como una medida de la población de respuesta sináptica excitatoria [65] , refleja un sumidero de corriente monosináptico [66] , y se correlaciona bien con la respuesta postsináptica excitatoria intracelular evocada en este vía [67] . La medición de la pendiente potencial de campo, como habitualmente utilizados, por ejemplo, en el hipocampo, no se ha utilizado para el campo neocortical posibles respuestas debido a la interferencia de la parte inicial de la respuesta de los componentes no sinápticos variables [68] . Después de 20 min de estimulación basal, focal y la reducción transitoria de Y-aminobuturic ácido-A (GABA) la inhibición en el sitio de la grabación fue producida por la aplicación de metyoduro bicuculina (3,3 mM, Tocris Bioscience) a partir de una micropipeta al tocar la punta a la superficie de la rebanada dentro de los 100 m de la microelectrodo de grabación durante 15-60 s. La pipeta se eliminó cuando la amplitud de las respuestas de prueba aumentó 50% -100% de la línea de base [66] . Inmediatamente después de la aplicación bicuculina, LTP se intentó mediante la entrega de TBS en la intensidad de estimulación basal doble. La inducción de LTP se intentó mediante el uso de TBS, que consistía en 10 trenes de estímulos a 5 Hz. Cada tren se compone de cuatro pulsos a 100 Hz. Esta secuencia fue entregado cada 10 s para un total de cinco presentaciones. LTP se registró durante al menos 20 min después de que se alcanzó una meseta estable. TBS se indujo respuestas hasta que se saturaron. Rutas se consideraron saturada si la diferencia entre dos estados posteriores de la LTP no fueron significativamente diferentes [68] . LTP máxima se calcula como un porcentaje del valor inicial, representa como media ± SEM y se analizó mediante la prueba t de Student. Se recogieron los datos, almacenados y analizados con LabVIEW (National Instruments) y MATLAB (The MathWorks) de software.

Información de Apoyo

Figure_S1.tif
S1PR2 expresión en fibroblastos 3T3 y células granulares del cerebelo inmaduros.(A, B) La tinción de inmunofluorescencia de las células 3T3 (A) y P8 de células granulares del cerebelo con neuritas y del cono de crecimiento (B) para S1PR2, núcleos (DAPI), y F-actina ( faloidina-Alexa488). Las barras de escala: 50 m.
S1PR2 expresión en fibroblastos 3T3 y células granulares del cerebelo inmaduros. (A, B) La tinción de inmunofluorescencia de las células 3T3 (A) y P8 de células granulares del cerebelo con neuritas y del cono de crecimiento (B) para S1PR2, núcleos (DAPI), y F-actina ( faloidina-Alexa488). Las barras de escala: 50 m.
doi: 10.1371/journal.pbio.1001763.s001
(TIF)
La pureza de las preparaciones de membrana de plasma y especificidad de medida S1PR2 anticuerpo Ab14533.1. análisis (A) de transferencia de Western de preparaciones de membrana de plasma 3T3 revela cantidad no detectable de las membranas endosomal EEA1-positivo, pero de alto contenido de plasma de Pan-CDH-positivo fracciones de membrana en comparación con lisados ​​de células enteras. MP, preparaciones de membrana; L, lisado de células enteras. (B) Ab14533.1 detecta S1PR2 en extractos de tejido cerebral enteros. La expresión de proteínas es mayor en las fases embrionarias (E11.5, E14.5) que en los animales adultos. Señales S1PR2 se reducen fuertemente cuando desafiado en un ensayo de competición con el péptido inmunogénico (P). (C) El análisis inmunohistoquímico de S1PR2 en la corteza motora adulta (comparar con la Figura 1E y 1F ) muestra abolió la detección S1PR2 utilizando el mismo ensayo de competición péptido.
doi: 10.1371/journal.pbio.1001763.s002
(TIF)
El bloqueo de S1PR1, 3, 4, y / o 5 no tiene ningún efecto sobre la inhibición de la propagación de células mediada por Nogo-A-Δ20. (A) fibroblastos 3T3 se sembraron en diferentes concentraciones de un sustrato de Nogo-A-Δ20 en presencia de aumentar concentraciones de JTE-013 frente al vehículo (DMSO). (B) los fibroblastos 3T3 se sembraron sobre un sustrato de Nogo-A-Δ20 en la presencia de los siguientes inhibidores farmacológicos: W146 para S1PR1, VPC-23019 para S1PR1 y 3, y FTY-720 para S1PR1, 3, 4, y 5. DMSO se utilizó como control. Un anticuerpo anti-S1PR5 función de bloqueo no tuvo ningún efecto sobre la inhibición inducida por Nogo-A-Δ20 en comparación con el control anti-BrdU. (C) los fibroblastos 3T3 se sembraron sobre un sustrato de Nogo-A-Δ20 en presencia de JTE-013 en diferentes combinaciones con VPC-23019, W146 y / o anti-S1PR5. DMSO se utilizó como control. Los datos mostrados son medias ± SEM ( n = 3-4 experimentos, * p < 0,05, ** p <0,01, *** p < 0,001).
doi: 10.1371/journal.pbio.1001763.s003
(TIF)
Eficacia de abatimiento de S1PR2, G q , G 12 , G 13 , y LARG. (A) Análisis cuantitativo de RT-PCR de la expresión S1PR2 en células 3T3 que expresan establemente S1pr2 shRNA (sh-S1pr2 ) versus el control de vectores (sh-Vec) reveló una ~ 93% caída. (B) Análisis de FACS de la expresión S1PR2 en células 3T3 que expresan establemente SH- S1pr2 o SH-Vec utilizando el anticuerpo Ab14533.1. (C) Análisis de RT-PCR cuantitativa de células 3T3 tratadas con siRNA dirigidos Q , 12 , 13 , o Larg durante 72 h. ARNsi revueltos (Ctrl) se utilizó como control. Cuantificación relativa de la eficacia de abatimiento: 12 (~ 77%), 13 (~ 78%), Q (~ 79%), y Larg (83%). (D) FACS análisis G 13 expresión en 13 en comparación con las células tratadas con siRNA 3T3 ctrl. (E) RT-PCR cuantitativa análisis de las neuronas corticales de rata E19 tratados en DIV4 con siRNA dirigidos 12 o 13 durante 72 h. ARNsi revueltos (Ctrl) se utilizó como control. Cuantificación relativa de la eficacia knock-down: 12(39%), 13 (42%). Análisis (F) FACS G 13 expresión en 13 frente ctrl tratados con siRNA neuronas corticales E19. Análisis (G) FACS de expresión LARG en Larg frente a las células tratadas con siRNA ctrl 3T3. Se muestran los histogramas de un experimento representativo.Los datos mostrados son medias ± SEM ( n = 3 experimentos).
doi: 10.1371/journal.pbio.1001763.s004
(TIF)
Bloqueo S1PR2 no tiene efecto en Nogo-66-y la inhibición mediada por Aggrecan del crecimiento de neuritas. (A, B) La media de la cuantificación longitud de las neuritas de P5-8 CGCs tratados con JTE-013 o DMSO y se sembraron en una de Nogo-66 (A) o Aggrecan (B) frente ctrl (PLL) del sustrato. Los datos mostrados son medias ± SEM ( n = 4 repeticiones).
doi: 10.1371/journal.pbio.1001763.s005
(TIF)
La inhibición farmacológica de S1PR1 y 3 o S1PR1, 3, 4, y 5 no aumenta hipocampo LTP. (A, B) WT rebanadas de hipocampo fueron tratados con VPC-23019 ( n = 7) (A) o FTY-720 ( n = 8) (B) para bloquear S1PR1 y 3 o S1PR1, 3, 4 y 5, respectivamente. DMSO se utilizó como control en (A) ( n = 11) y (B) ( n = 9). No hay diferencias significativas en la LTP se pudo observar entre VPC-23019, FTY-720 y el tratamiento de DMSO. (C) PPF no reveló alteraciones en VPC-23019-( n = 5) o FTY-720-( n = 7) frente a DMSO-( n = 7) rebanadas tratadas. (D) No hay diferencia significativa en la LTP se pudo observar en S1PR2 - / - ( n = 11) frente a WT ( n = 12) ratones. (E) la fuerza de entrada-salida no reveló alteraciones en S1PR2 - / - ( n = 8) en comparación con WT ( n = 12) ratones. (F) PPF no reveló alteraciones en S1PR2 - / - ( n = 11) frente a WT ( n = 13) ratones. (G) No hay diferencia significativa en la depresión del hipocampo a largo plazo (LTD) se pudo observar entre JTE-013-( n = 4) frente a DMSO-( n = 5) rebanadas WT tratados. Las flechas indican el inicio de theta-ráfaga (A, B, D) o de baja frecuencia (G) la estimulación. Los datos mostrados son medias ± SEM. n indica el número de ratones utilizados.
doi: 10.1371/journal.pbio.1001763.s006
(TIF)

Agradecimientos